DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Atp8b3

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_234937.3 Gene:Atp8b3 / 299616 RGDID:1307622 Length:1340 Species:Rattus norvegicus


Alignment Length:56 Identity:16/56 - (28%)
Similarity:22/56 - (39%) Gaps:16/56 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LAFKQYLELDFDETFVPEGEEKGRGTFNC-------HNF-------ARKYAL--GN 168
            |.|:|.|.:...|...|:.....:|...|       |:|       :|||.|  ||
  Rat   190 LKFRQALMVTHHELTSPKKMASFQGIVTCEEPNSRMHHFVGSLEWNSRKYPLDIGN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 16/56 (29%)
Atp8b3XP_234937.3 PhoLip_ATPase_N 20..96 CDD:292826
ATPase-Plipid 45..1143 CDD:273734 16/56 (29%)
Cation_ATPase 483..577 CDD:289987
COG4087 <839..890 CDD:226572
PhoLip_ATPase_C 883..1131 CDD:292829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.