DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and CG33298

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_995666.1 Gene:CG33298 / 2768929 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster


Alignment Length:61 Identity:15/61 - (24%)
Similarity:27/61 - (44%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNNTEWLIW 93
            :.::.||.||..:...||   :.|..:|.:.|:..  |....|:|....:...:.|:|  |
  Fly   954 SSIMPVLVPCSHNSPEGI---LREQTQQLLDRYAR--EGLRILVMAKRTLNSADYTDW--W 1007

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 15/60 (25%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826
ATPase-Plipid 250..1473 CDD:273734 15/61 (25%)
E1-E2_ATPase 302..>394 CDD:278548
Cation_ATPase <880..965 CDD:289987 4/10 (40%)
HAD_like <1177..1240 CDD:304363
PhoLip_ATPase_C 1223..1468 CDD:292829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.