DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and SPBC2F12.10

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:SPBC2F12.10 / 2540365 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:42/162 - (25%)
Similarity:66/162 - (40%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IKPGIMVVINETLKQP---IIRFKADPEHYHTLMMVDLDVPPDNNTEW---LIWMVGNIP---GC 101
            |.||.::....|:|.|   ::.|.....|| :::.:|||||......:   ..|::.|||   ..
pombe   144 ITPGTILPSTVTVKTPWLSVLPFNCKKNHY-SVITLDLDVPNYETNRFETHCNWLLTNIPIEASK 207

  Fly   102 DVAMGQTLVAYDNRRTI--HGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKY 164
            .|.:..:...:..|..|  .|.:.|||:.|..:|    ......:| .....|..|:...|...|
pombe   208 RVPIDTSKAFFQYRPPIVHRGEDKHRILTLVLRQ----KSSSISIP-SNALVRERFDLSEFCSIY 267

  Fly   165 ALGNPMAANFYLVEWLWR--W--TPTYLVSEH 192
            .| .|:.|:      |||  |  ....|:|:|
pombe   268 DL-EPVGAH------LWRSGWDSDAVALLSKH 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 35/141 (25%)
SPBC2F12.10NP_001342831.1 PEBP_euk 130..279 CDD:176644 37/147 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.