DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Pebp1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_061346.2 Gene:Pebp1 / 23980 MGIID:1344408 Length:187 Species:Mus musculus


Alignment Length:115 Identity:38/115 - (33%)
Similarity:55/115 - (47%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DPEHYHTLMMVDLDVPPDNN---TEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFL 129
            ||...:||::.|.|.|...:   .||..::|.|:.|.|::.|..|..|.......|:.:||.|:|
Mouse    59 DPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWL 123

  Fly   130 AFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYLVEW 179
            .::|...|..||..:.......||.|....|.:||.||.|:|...|..||
Mouse   124 VYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 36/111 (32%)
Pebp1NP_061346.2 PEBP_euk 25..171 CDD:176644 36/111 (32%)
Interaction with RAF1. /evidence=ECO:0000250 93..134 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.