DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Y69E1A.5

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_502042.1 Gene:Y69E1A.5 / 190551 WormBaseID:WBGene00013477 Length:172 Species:Caenorhabditis elegans


Alignment Length:173 Identity:49/173 - (28%)
Similarity:82/173 - (47%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RHHVIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFK---ADPEHYHTLMMVDLD 81
            :|.:.|::....|.:.:.:.:. .|.::||:.:.:......|  |:.   ||||..:|::|:|  
 Worm    10 QHEITPKIIENAPKQKLHLCWD-GIQVEPGMTMQVRNLKNAP--RWALPGADPESIYTVLMID-- 69

  Fly    82 VPPDNNT-------EWLIWMVGNIPGCDVA----MGQTLVAYDNRRTIHGSNIHRIVFLAFKQYL 135
              |||.:       |||.|:|.|||..::.    .||..:||.:......:::||.|.|.:    
 Worm    70 --PDNLSRKNPSVAEWLHWLVCNIPASNIIDGINGGQHQMAYGSPAPGPRTDLHRYVILMW---- 128

  Fly   136 ELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYLVE 178
            |.......||  :...|..||...|..|..||:|:|.||:|.:
 Worm   129 EHAGRRISVP--KPSSRAKFNVKQFIEKNKLGDPIAGNFFLAQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 45/156 (29%)
Y69E1A.5NP_502042.1 PEBP_euk 25..168 CDD:176644 45/155 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.