DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and F40A3.3

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001300105.1 Gene:F40A3.3 / 179168 WormBaseID:WBGene00018218 Length:226 Species:Caenorhabditis elegans


Alignment Length:173 Identity:51/173 - (29%)
Similarity:80/173 - (46%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RHHVIPRLFACK-PTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVP 83
            :|.|||.:.|.. |:||:||.:...::...|.::...:....|.:::.|:|...:||:..|.|.|
 Worm    49 KHEVIPDVLASNPPSKVVSVKFNSGVEANLGNVLTPTQVKDTPEVKWDAEPGALYTLIKTDPDAP 113

  Fly    84 PDNN---TEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVP 145
            ....   .||..|:|.||||.|:|.|.||..|........:.:||.|:|.:||...:        
 Worm   114 SRKEPTYREWHHWLVVNIPGNDIAKGDTLSEYIGAGPPPKTGLHRYVYLIYKQSGRI-------- 170

  Fly   146 EGEEKG---------RGTFNCHNFARKYALGNPMAANFYLVEW 179
            |..|.|         ||.:...:|..|:.||.|:..|.:..|:
 Worm   171 EDAEHGRLTNTSGDKRGGWKAADFVAKHKLGAPVFGNLFQAEY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 44/154 (29%)
F40A3.3NP_001300105.1 PEBP_euk 64..211 CDD:176644 44/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.