DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and PEBP4

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001350162.1 Gene:PEBP4 / 157310 HGNCID:28319 Length:227 Species:Homo sapiens


Alignment Length:154 Identity:45/154 - (29%)
Similarity:70/154 - (45%) Gaps:20/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QPIIRF--KADPEHYHTLMMVDLDVPPDNNTE-----WLIWMVGNIPGCDV----AMGQTLVAYD 113
            :||::|  ..|...| .|:|||.|.|  :..|     |..|:|.:|.|.|:    ..||.|.||.
Human    76 EPIVKFPGAVDGATY-ILVMVDPDAP--SRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQ 137

  Fly   114 NRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYLVE 178
            .......|..||..|..   ||:.....:.:|: |.|.||::....|..::.||.|.|:..::.:
Human   138 APSPPAHSGFHRYQFFV---YLQEGKVISLLPK-ENKTRGSWKMDRFLNRFHLGEPEASTQFMTQ 198

  Fly   179 WLWRWTPTYLV-SEHEFEPSNGNE 201
             .::.:||... .|...||.:.|:
Human   199 -NYQDSPTLQAPRERASEPKHKNQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 39/127 (31%)
PEBP4NP_001350162.1 PEBP_euk 46..197 CDD:176644 39/127 (31%)
Important for secretion. /evidence=ECO:0000269|PubMed:27033522 188..227 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.