DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30060 and Atp10a

DIOPT Version :9

Sequence 1:	NP_725293.1	Gene:	CG30060 / 246426	FlyBaseID:	FBgn0265272	Length:	202	Species:	Drosophila melanogaster
Sequence 2:	NP_033858.2	Gene:	Atp10a / 11982	MGIID:	1330809	Length:	1508	Species:	Mus musculus

Alignment Length:	69	Identity:	15/69 - (21%)
Similarity:	31/69 - (44%)	Gaps:	23/69 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 VSCPILCPVEKLVTELKRHHVIPRLFACKPTKVI-SVLYPCDIDIKPGIMVVINETLKQPIIRFK 66
            ::| ::.|:..|         :||||    .|.: ..|:|..:.:.       .:..|:|:.:|
Mouse  1290 LTC-LIAPIAAL---------LPRLF----FKALQGSLFPTQLQLG-------RQLAKKPLNKF- 1332

  Fly    67 ADPE 70
            :||:
Mouse  1333 SDPK 1336

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG30060	NP_725293.1	PEBP_euk	34..177	CDD:176644	8/38 (21%)
Atp10a	NP_033858.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..23
		P-type_ATPase_APLT_Dnf-like	65..1203	CDD:319770
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	680..705
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1334..1354		2/3 (67%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1407..1436
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1481..1508
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0206
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900