DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and pebp1.1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_002938131.1 Gene:pebp1.1 / 100497751 XenbaseID:XB-GENE-22069563 Length:185 Species:Xenopus tropicalis


Alignment Length:133 Identity:37/133 - (27%)
Similarity:59/133 - (44%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VINETLKQ--PIIRFKA-DPEHYHTLMMVDLDVPPDNNT---EWLIWMVGNIPGCDVAMGQTLVA 111
            |:..|..|  |.|.::: |....:|::..|.|||.....   ||..::..|:.|.|::.|..|.|
 Frog    40 VLTPTQVQHCPNIEWESMDSSKLYTVIFTDPDVPSRKECHLGEWHHFLAVNVKGNDLSSGCILTA 104

  Fly   112 YDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYL 176
            |.......|:.:||...|.::|...:...|..:.....:.||.|....|.:||.|..|:|...:.
 Frog   105 YVGSGPGKGTGLHRYTILVYEQAGRVQCTERILGNTSAEHRGKFKASEFRKKYKLAAPIAGTCFQ 169

  Fly   177 VEW 179
            .||
 Frog   170 AEW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 35/129 (27%)
pebp1.1XP_002938131.1 PEBP_euk 24..170 CDD:176644 35/129 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.