DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and atp8b1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_001920510.4 Gene:atp8b1 / 100148342 ZFINID:ZDB-GENE-091116-14 Length:1249 Species:Danio rerio


Alignment Length:100 Identity:20/100 - (20%)
Similarity:36/100 - (36%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNNTEWLIWMVGNI----PGCDVAMGQTLVAY 112
            |.::.|.....|:....|:.|..|.::|.:......:..|.:..|.|    .|.|..:.|.|...
Zfish   562 VFLSRTQDTITIQEMDKPQTYTMLALLDFNSDRKRMSIILKFPDGRIRLYCKGADTVIYQRLSPQ 626

  Fly   113 DNRR-------TIHGSNIHRIVFLAFKQYLELDFD 140
            ...:       .|..:...|.:.|.:|...:.:||
Zfish   627 SKNKENTQEALDIFANETLRTLCLCYKDISQEEFD 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 19/99 (19%)
atp8b1XP_001920510.4 PhoLip_ATPase_N 60..137 CDD:292826
ATPase-Plipid 86..1176 CDD:273734 19/99 (19%)
E1-E2_ATPase 142..>228 CDD:278548
Cation_ATPase 527..624 CDD:289987 13/61 (21%)
HAD_like <872..915 CDD:304363
PhoLip_ATPase_C 915..1169 CDD:292829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.