DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30059 and Arsg

DIOPT Version :9

Sequence 1:NP_610872.1 Gene:CG30059 / 246425 FlyBaseID:FBgn0260475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001348904.1 Gene:Arsg / 74008 MGIID:1921258 Length:525 Species:Mus musculus


Alignment Length:457 Identity:114/457 - (24%)
Similarity:168/457 - (36%) Gaps:149/457 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLIVLVLACLGNTASEKLPNILLILSDDQ---DVELRGMFPMEHT-IEMLGFGGALFHNAYTPSP 66
            ||:...::  |.|.:.: |||::||:||.   |:........:.| ::.:...|..|.:.:..:.
Mouse    21 PLVDFSIS--GKTRAPQ-PNIVIILADDMGWGDLGANWAETKDTTNLDKMASEGMRFVDFHAAAS 82

  Fly    67 ICCPARTSLLTGMYAHNHGTRNN----SVSG------------------------------GCYG 97
            .|.|:|.|||||.....:|..:|    ||.|                              |.|.
Mouse    83 TCSPSRASLLTGRLGLRNGVTHNFAVTSVGGLPVNETTLAEVLRQEGYVTAMIGKWHLGHHGSYH 147

  Fly    98 PHWRRALEPRALPYILQQHGYNTFFGGKYLNQYWGAGDVPKGWNNFY----------GLHGNSRY 152
            |::|               |::.:||..|.|. .|..|.| |:|  |          ||..|...
Mouse   148 PNFR---------------GFDYYFGIPYSND-MGCTDAP-GYN--YPPCPACPQRDGLWRNPGR 193

  Fly   153 YNYT-----LRENTGNVHYESTYLSDLLR---DRAADFLRNATQSSEPFFAMVAPPAAHEPFTPA 209
            ..||     |.||. |:..:...||.|.:   :||.:|:..|:.|..||...|.....|.|.:..
Mouse   194 DCYTDVALPLYENL-NIVEQPVNLSGLAQKYAERAVEFIEQASTSGRPFLLYVGLAHMHVPLSVT 257

  Fly   210 PRHEGVFSHIEALRTPSFNQVKQDKHWLVRAARRLPNETINTIDTYFQKRWETLLAVDELVVTLM 274
            |              |..:..:|.   |.||:.|                     .:|.||..:.
Mouse   258 P--------------PLAHPQRQS---LYRASLR---------------------EMDSLVGQIK 284

  Fly   275 GVLNDTQSLENTYIIYTSDNGYHVGQFAQ---------PF------------DKRQPYETDINVP 318
            ..: |..:.|||.:.:|.||    |.:||         ||            .|:..:|....||
Mouse   285 DKV-DHVARENTLLWFTGDN----GPWAQKCELAGSVGPFFGLWQTHQGGSPTKQTTWEGGHRVP 344

  Fly   319 LLIRGPGIAPESHIDTA-VSLVDLAPTILAWADIDTP--SYMDGQSFHELLLNKRR---RVPFFE 377
            .|...||..|.:...|| :||:|:.||::|.|....|  ...||:...|:|..|.:   ||.|..
Mouse   345 ALAYWPGRVPANVTSTALLSLLDIFPTVIALAGASLPPNRKFDGRDVSEVLFGKSQMGHRVLFHP 409

  Fly   378 RS 379
            .|
Mouse   410 NS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30059NP_610872.1 G6S 24..467 CDD:293766 110/439 (25%)
AslA 24..464 CDD:225661 110/439 (25%)
ArsgNP_001348904.1 ARSG 35..469 CDD:293780 110/441 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.