DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30059 and Sulf1

DIOPT Version :9

Sequence 1:NP_610872.1 Gene:CG30059 / 246425 FlyBaseID:FBgn0260475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster


Alignment Length:378 Identity:154/378 - (40%)
Similarity:215/378 - (56%) Gaps:11/378 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NTASEKLPNILLILSDDQDVELRGMFPMEHTIEMLGFGGALFHNAYTPSPICCPARTSLLTGMYA 81
            |:|.|:.|||:|||:|||||||..:..|..|:.:|..|||.|.:|||.:|:|||||:|||||||.
  Fly    47 NSARERRPNIILILTDDQDVELGSLNFMPRTLRLLRDGGAEFRHAYTTTPMCCPARSSLLTGMYV 111

  Fly    82 HNHGTRNNSVSGGCYGPHWRRALEPRALPYILQQHGYNTFFGGKYLNQYWGAGDVPKGWNNFYGL 146
            |||....|  :..|..|.|:...|.|:....|...||.|.:.|||||:|.|: .:|.||..:.||
  Fly   112 HNHMVFTN--NDNCSSPQWQATHETRSYATYLSNAGYRTGYFGKYLNKYNGS-YIPPGWREWGGL 173

  Fly   147 HGNSRYYNYTLRENTGNV----HYESTYLSDLLRDRAADFLRNATQSSE--PFFAMVAPPAAHEP 205
            ..||:||||::..|...:    .|...|..||:.:.:..|||::.|.::  |....::.||.|.|
  Fly   174 IMNSKYYNYSINLNGQKIKHGFDYAKDYYPDLIANDSIAFLRSSKQQNQRKPVLLTMSFPAPHGP 238

  Fly   206 FTPAPRHEGVFSHIEALRTPSFNQV-KQDKHWLVRAARRLPNETINTIDTYFQKRWETLLAVDEL 269
            ...||::..:|.::....|||::.. ..||.|::|....:........:....||.:||.:||..
  Fly   239 EDSAPQYSHLFFNVTTHHTPSYDHAPNPDKQWILRVTEPMQPVHKRFTNLLMTKRLQTLQSVDVA 303

  Fly   270 VVTLMGVLNDTQSLENTYIIYTSDNGYHVGQFAQPFDKRQPYETDINVPLLIRGPGIAPESHIDT 334
            |..:...|.:...|:||||:||||:|||:|||.....|..|:|.|:.||.|||||||.....::.
  Fly   304 VERVYNELKELGELDNTYIVYTSDHGYHLGQFGLIKGKSFPFEFDVRVPFLIRGPGIQASKVVNE 368

  Fly   335 AVSLVDLAPTILAWADIDTPSYMDGQSFHELLLNKRRRV-PFFERSLLIEYWG 386
            .|..||||||.|....:.||.:|||:|...|||::.|.| ..:..|.|||..|
  Fly   369 IVLNVDLAPTFLDMGGVPTPQHMDGRSILPLLLSRNRAVRDNWPDSFLIESSG 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30059NP_610872.1 G6S 24..467 CDD:293766 151/371 (41%)
AslA 24..464 CDD:225661 151/371 (41%)
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 142/349 (41%)
G6S 53..408 CDD:293766 145/357 (41%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466501
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1273622at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.