DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30059 and sulf2b

DIOPT Version :9

Sequence 1:NP_610872.1 Gene:CG30059 / 246425 FlyBaseID:FBgn0260475 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_009294986.2 Gene:sulf2b / 322056 ZFINID:ZDB-GENE-030131-775 Length:1293 Species:Danio rerio


Alignment Length:248 Identity:55/248 - (22%)
Similarity:91/248 - (36%) Gaps:74/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RNATQSSEPFFAMVAPPAAHEPFTPAPRHEGVFSHIEALRTPSF--NQV-------KQDKHWLVR 239
            |.|.||......:|..|   |.||..     ||...:||:..:|  :.|       .:|.|.::|
Zfish  1066 RFAMQSQHSVTQLVRDP---EEFTTI-----VFGKTDALKYFTFISDDVALVQFHPTEDSHRIIR 1122

  Fly   240 AARRLPNETINTIDTYFQKRW---ETLLAVDELVVTLMGVLNDTQSLENTYIIYTS--------- 292
                    .||.....:...|   |....:|:|...|:  .:||.|     :|:.|         
Zfish  1123 --------DINVFVAAYTTSWARLELYKLMDKLGDRLL--YSDTDS-----VIFVSKAGDWMPPL 1172

  Fly   293 -----------DNGYHVGQFAQPFDKRQPYETDINVPLLIRGPGIAPES------HIDTAVSLVD 340
                       .:|.::.:|.....|...|.| .:..:.::..||...:      .:||.:.|||
Zfish  1173 GDYLGDLTDEIGDGDYITEFCSSGPKSYGYRT-ASGKVCMKAKGITLNAKNSQTIRLDTLIGLVD 1236

  Fly   341 LAPT-------ILAWAD--IDTPSYMDGQSFHELLLNKRRRVPFFERSLLIEY 384
            ...|       |||.||  :....::   :.|...:.|:.:|.:.:|.||.:|
Zfish  1237 GYVTSGDDSRYILAQADNIVRNKKHL---TLHNKSVVKKFKVVYNKRRLLPDY 1286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30059NP_610872.1 G6S 24..467 CDD:293766 55/248 (22%)
AslA 24..464 CDD:225661 55/248 (22%)
sulf2bXP_009294986.2 DNA_pol_B_2 519..1146 CDD:332879 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1273622at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.