DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30059 and Arsi

DIOPT Version :9

Sequence 1:NP_610872.1 Gene:CG30059 / 246425 FlyBaseID:FBgn0260475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001041346.1 Gene:Arsi / 307404 RGDID:1310242 Length:573 Species:Rattus norvegicus


Alignment Length:383 Identity:96/383 - (25%)
Similarity:149/383 - (38%) Gaps:95/383 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NTASEKLPNILLILSDDQ---DVELRGMFPMEHTIEMLGFGGALFHNAYTPSPICCPARTSLLTG 78
            :.|..:.|:|:.||:|||   ||...|......|::.|...|....|.|. .|||.|:|:.||||
  Rat    40 SAAPPQPPHIIFILTDDQGYHDVGYHGSDIETPTLDRLAAEGVKLENYYI-QPICTPSRSQLLTG 103

  Fly    79 MYAHNHGTRNNSV---SGGCYGPHWRRALEPRALPYILQQHGYNTFFGGKYLNQYWGAGDVP--K 138
            .|..:.|.:::.:   ...|.      .|:...||..||:.||:|...||:...::....:|  :
  Rat   104 RYQIHTGLQHSIIRPRQPNCL------PLDQVTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRR 162

  Fly   139 GWNNFYG-LHGNSRYYNYTLRENTG----NVH--------YESTYLSDLLRDRAADFLRNATQS- 189
            |::.|.| |.||..||.|...:..|    ::|        ....|.:.|...||:..|  |:.| 
  Rat   163 GFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGESVAWGLSGQYSTMLYAQRASHIL--ASHSP 225

  Fly   190 SEPFFAMVAPPAAHEPFTPAPRHEGVFSHIEALRTPSFNQVKQDKHWLVRAARRLPNETINTIDT 254
            .:|.|..||..|.|.|                |::|        :.:|.|         ..|:..
  Rat   226 QKPLFLYVAFQAVHTP----------------LQSP--------REYLYR---------YRTMGN 257

  Fly   255 YFQKRWETLL-AVDELVVTLMGVLNDTQSLENTYIIYTSDNGYHVGQFAQPFDKRQPYETDINVP 318
            ..::::..:: .:||.|..:...|.......|:.||::||||            .|.:....|.|
  Rat   258 VARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDNG------------GQTFSGGSNWP 310

  Fly   319 LL----------IRGPGIAPESHID-------TAVSLVDLAPTILAWADIDTPSYMDG 359
            |.          :||.|......:.       ..|.:.|..||::..|. .|.|..||
  Rat   311 LRGRKGTYWEGGVRGLGFVHSPLLKKKRRTSRALVHITDWYPTLVGLAG-GTTSAADG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30059NP_610872.1 G6S 24..467 CDD:293766 95/376 (25%)
AslA 24..464 CDD:225661 95/376 (25%)
ArsiNP_001041346.1 4-S 48..478 CDD:293753 94/375 (25%)
AslA 49..485 CDD:225661 94/374 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.