DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30059 and Galns

DIOPT Version :9

Sequence 1:NP_610872.1 Gene:CG30059 / 246425 FlyBaseID:FBgn0260475 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_017456734.1 Gene:Galns / 292073 RGDID:1565391 Length:567 Species:Rattus norvegicus


Alignment Length:344 Identity:80/344 - (23%)
Similarity:122/344 - (35%) Gaps:86/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LRGMFPMEHTIEMLGFGGALFH--NAYTPSPIC--CPARTSLLTGMYAHNHGTRNNSVSGGCYGP 98
            |.|..|:.:     ||.....|  |||||..|.  .|....||..:......|  |.:.|     
  Rat   131 LTGRLPIRN-----GFYTTNAHARNAYTPQEIMGGIPNSEHLLPELLKKAGYT--NKIVG----- 183

  Fly    99 HWRRALEPRALPYILQQHGYNTFFG------GKYLNQYWGAGDVPKGWNNFYGLHGNSRYY-NYT 156
            .|.....|:..|.   :||::.:||      |.|.|:......|.:.|...      .|:| .:.
  Rat   184 KWHLGHRPQFHPL---KHGFDEWFGSPNCHFGPYDNKVKPNIPVYRDWEMV------GRFYEEFP 239

  Fly   157 LRENTGNVHYESTYLSDLLRDRAADFLRNATQSSEPFFAMVAPPAAHEPFTPAPRHEGVFSHIEA 221
            :...||..:....||.:     |.||:|.......|||...|..|.|.|                
  Rat   240 INLKTGEANLTQLYLQE-----ALDFIRTQHARQSPFFLYWAIDATHAP---------------- 283

  Fly   222 LRTPSFNQVKQDKHWLVRAARRLPNETINTIDTYFQKRWETLLAVDELVVTLMGVLNDTQSLENT 286
                    |...|.:|..:.|....:.:..|              |:.|..::.:|.:....:||
  Rat   284 --------VYASKQFLGTSLRGRYGDAVREI--------------DDSVGKILSLLQNLGISKNT 326

  Fly   287 YIIYTSDNGYHV------GQFAQPF--DKRQPYETDINVPLLIRGPGIAPESHIDTAV-SLVDLA 342
            ::.:|||||..:      |....||  .|:..:|..:..|.:...||......:...: |::||.
  Rat   327 FVFFTSDNGAALISAPKEGGSNGPFLCGKQTTFEGGMREPAIAWWPGHIAAGQVSHQLGSIMDLF 391

  Fly   343 PTILAWADIDTPS--YMDG 359
            .|.|:.|.:..||  .:||
  Rat   392 TTSLSLAGLKPPSDRVIDG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30059NP_610872.1 G6S 24..467 CDD:293766 80/344 (23%)
AslA 24..464 CDD:225661 80/344 (23%)
GalnsXP_017456734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351126
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.