DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30054 and Galphao

DIOPT Version :9

Sequence 1:NP_001036538.3 Gene:CG30054 / 246420 FlyBaseID:FBgn0050054 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster


Alignment Length:355 Identity:159/355 - (44%)
Similarity:215/355 - (60%) Gaps:3/355 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHCCSSTEAMEKRRINEEIDKQLRLEKKRSKRELKLLLLGACESGKSTFIKQMRIIHGSGYSDED 65
            |.|..|.|.......:..|::.|:.:..::.:::|||||||.||||||.:|||:|||.||::.||
  Fly     1 MGCAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAED 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTT--FEDPYLNAIKT 128
            .:.|..:|:.|...::.::::||..|.|.|...|....|.:|..:......|  |.:..|.|:|.
  Fly    66 FKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKR 130

  Fly   129 LWHDAGIQECYDRRREYQLTDSTEYFLGDIGRIEQADYLPTNQDILRAREPTFNITVYPFELDGY 193
            ||.|||:|||:.|..||||.||.:|||.|:.|:...||.||.|||||.|..|..|....|.....
  Fly   131 LWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNL 195

  Fly   194 VLSMVDVAGQRTERRKWIHFFSNVTSIIFLAALSEYDQFMMESENDNRLEESKALFHTIITFEWF 258
            ...:.||.|||:||:||||.|.:||:|||..|:|||||.:.|.|..||::||..||.:|...:||
  Fly   196 NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWF 260

  Fly   259 KNASIILFLNKMDVLEEKIMYSHLVDYFPEYDGPKQDAYAAREYVLRMFQSISLDTYKKIYSHFT 323
            .:.||||||||.|:.||||..|.|...||||.|.::...|| .|:...|::.:..|.|:||.|.|
  Fly   261 TDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAA-AYIQAQFEAKNKSTSKEIYCHMT 324

  Fly   324 CATDTENIKFVFAAVKDTILQCNLKESNLF 353
            |||||.||:|||.||.|.|:..||:...|:
  Fly   325 CATDTNNIQFVFDAVTDVIIANNLRGCGLY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30054NP_001036538.3 G_alpha 13..351 CDD:214595 154/339 (45%)
G-alpha 34..347 CDD:206639 150/314 (48%)
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 150/314 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455789
Domainoid 1 1.000 229 1.000 Domainoid score I660
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I1124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm3584
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
98.990

Return to query results.
Submit another query.