DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30053 and PSR

DIOPT Version :9

Sequence 1:NP_725221.1 Gene:CG30053 / 246419 FlyBaseID:FBgn0050053 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster


Alignment Length:187 Identity:43/187 - (22%)
Similarity:65/187 - (34%) Gaps:56/187 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KEMLAVCQPLIWRIRLARIKKWFFILLP----------LMVIYLLWLCSDTF----SWWLSALGR 70
            ||:|.|...:..:.|...| .||..:.|          ...|.:|....:|.    .||...|..
  Fly   220 KELLKVTSAMGGKQRDEAI-TWFSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNM 283

  Fly    71 LVLIQILP----------LWD----WRPYYHAKCLIPRDQSVQEQAPSLGK-AETLRQNCDLCEG 120
            ...|.|..          :|.    .||....|.|    :.:::|.|.|.: |:::..|      
  Fly   284 DDTIAITQNFSSQTNFPCVWHKTVRGRPKLSRKWL----RVLRDQRPELAQIADSINLN------ 338

  Fly   121 LEGIG----------TVSNVSYSSLESEHLERGQPVIITDTGLQTDVFSLLEQIEKK 167
             |..|          :.|:.|.||.|.|..:.|.. ..||:|.:    ||..:.:||
  Fly   339 -ESTGFASDSSSNSSSSSSSSSSSSEEEESDDGGD-SNTDSGQE----SLTAKKKKK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30053NP_725221.1 None
PSRNP_001262832.1 JmjC 179..293 CDD:202224 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.