DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30053 and CG2211

DIOPT Version :9

Sequence 1:NP_725221.1 Gene:CG30053 / 246419 FlyBaseID:FBgn0050053 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001261251.1 Gene:CG2211 / 38157 FlyBaseID:FBgn0035211 Length:330 Species:Drosophila melanogaster


Alignment Length:336 Identity:63/336 - (18%)
Similarity:126/336 - (37%) Gaps:73/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EELKVFFEECRGQGFSAKEMLAVCQPLIWRIRLARIKKWFFILLPLMVIYLLWLCSDTFSWWLSA 67
            :||:..|.:.|....:...:     .|:|.:.:.     |||::...|.|      :|.|:.|. 
  Fly    47 QELEEAFRKTRDMDHNPNRL-----NLLWLLGIV-----FFIMVATPVFY------ETISFLLG- 94

  Fly    68 LGRLVLIQILPLWDWRPYYHAKCLIPRDQSVQEQAPSLGKAETLRQNCDLCEGLEGIGTVSNVSY 132
                                .:|.:|.:..|.|....:       .:|:.|:|:.....::|::.
  Fly    95 --------------------VRCFLPNNYLVWEATRPI-------SDCEFCKGVRAPLILANLTM 132

  Fly   133 SSLESEHLERGQPVII--------TDTGLQTDVFSLLEQIEKKSPQWLTSEPC-------DVSSN 182
            ... :.|.....|:|:        ....|.   |:.::::.:..|..:.|: |       |:.| 
  Fly   133 EEF-APHAYSSMPIIVKRAVAHWPAQKNLS---FAFIKELYESVPGAMDSD-CQFLHFNSDLKS- 191

  Fly   183 LLLRKLFNLEAALDKIHSWQGQTSNSWHLQLRNCQKKAVKSSRLFLDRPYYYPLHLAPYYSSWLL 247
              |:.:|::.|  ::.:..||.   .|.:....||...:...|....||::.|......::.::|
  Fly   192 --LKHVFSMSA--ERSNLTQGV---PWFVGWSVCQPAVLAELRKLYPRPHFLPFDAEMPHTDFIL 249

  Fly   248 AVHQQKRNQADIYVRGLVLIQQLSGHFEMVLHPKKPCNKGICPSLRMRLNAGEGLIFTTDIWSLS 312
            ..::|.......|:..|:...||||:....|.|...|:.. |......:..|:.::..|.||..:
  Fly   250 MGYEQGAVMHLDYIPRLLWQAQLSGNKTWFLAPAPECDHQ-CQPFSFYVEPGDAVLVDTRIWYHA 313

  Fly   313 YGLEKPHGKLT 323
            ..:.|....||
  Fly   314 NSIPKGQFSLT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30053NP_725221.1 None
CG2211NP_001261251.1 cupin_like 133..>306 CDD:304367 35/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.