DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30053 and JMJD4

DIOPT Version :9

Sequence 1:NP_725221.1 Gene:CG30053 / 246419 FlyBaseID:FBgn0050053 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001286031.1 Gene:JMJD4 / 35089 FlyBaseID:FBgn0032671 Length:425 Species:Drosophila melanogaster


Alignment Length:227 Identity:46/227 - (20%)
Similarity:74/227 - (32%) Gaps:71/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VLIQILPLWDWRPYYHAKCLIPRDQSVQEQAPSLGKAETLRQNCDLCEGLEGIGTVSNVSYSSLE 136
            ||:|:.|                 :.|.|..|.      |.:..:.|.||:         |:...
  Fly    10 VLLQLHP-----------------EEVVETDPQ------LPEEIERCSGLD---------YNDFF 42

  Fly   137 SEHLERGQPVIITDTGLQTDVFSLLEQIEKKSPQW--LTSEPCDVSSNL--LLRKL--------- 188
            ..::.:..||||.:  :..|.......:.:.||:.  |.|.|...|.|.  |..|:         
  Fly    43 WRYMHKNIPVIIAN--VSNDWECQNWTVGQSSPESRDLNSNPSASSINFDYLKTKISDGPVPVAN 105

  Fly   189 -----FNLEAAL-----DKIHSW----QGQTSNSWHLQLRNCQKKAVKSSRLFL-------DRPY 232
                 ||....|     |.:..|    :.|:|.:|.....|..........|:|       ..|.
  Fly   106 CNSSYFNSHTKLELNFHDYLAKWRSSIESQSSAAWTSAEVNSNVAPASGDNLYLKDWHLAAQMPG 170

  Fly   233 YYPLHLAPYYSS-WL--LAVHQQKRNQADIYV 261
            |....:..|::| ||  ..:.|.|.:...:|:
  Fly   171 YNFYKVPKYFASDWLNEQLIQQGKDDYRFVYM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30053NP_725221.1 None
JMJD4NP_001286031.1 JmjC 172..221 CDD:214721 7/31 (23%)
JmjC 199..299 CDD:202224 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.