DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmem18 and AT1G34350

DIOPT Version :9

Sequence 1:NP_725169.3 Gene:Tmem18 / 246418 FlyBaseID:FBgn0050051 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001185136.1 Gene:AT1G34350 / 840336 AraportID:AT1G34350 Length:188 Species:Arabidopsis thaliana


Alignment Length:160 Identity:59/160 - (36%)
Similarity:84/160 - (52%) Gaps:36/160 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLLSIDWKDPWLIGLILAHILTTTTALLSRNSSNFQVFLFLV----------------------- 58
            |..:||||:||::||:..|.|.....||||...||.:||||:                       
plant    40 FFHAIDWKEPWIMGLMAFHALLLLVTLLSRRHLNFHMFLFLLACKFPLKLSIYILYKKSLRSNDL 104

  Fly    59 --LLLAVYFTESINEFAANNWSSFSRQQYFDSNGLFISTVFSIPILLNCMLLIGTWLYNSTQLMV 121
              |:..|||.|::|.....||.|||.|.||||||:|:||::|.|:|:..|:::...|::...|:|
plant   105 TSLVAGVYFAENLNRELRKNWKSFSTQNYFDSNGVFLSTLWSGPLLVIAMIILINTLFSLCYLIV 169

  Fly   122 TLKTAQLKERARKERQTKADSESIAHKKAE 151
            ..|.|:|:.|||           :||.|.|
plant   170 KWKRAELRHRAR-----------LAHTKEE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmem18NP_725169.3 TMEM18 15..133 CDD:291436 53/140 (38%)
AT1G34350NP_001185136.1 TMEM18 37..181 CDD:291436 53/140 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3344
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I2146
OMA 1 1.010 - - QHG58005
OrthoDB 1 1.010 - - D1575793at2759
OrthoFinder 1 1.000 - - FOG0007148
OrthoInspector 1 1.000 - - oto2868
orthoMCL 1 0.900 - - OOG6_104718
Panther 1 1.100 - - LDO PTHR22593
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.