DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmem18 and Tmem18

DIOPT Version :9

Sequence 1:NP_725169.3 Gene:Tmem18 / 246418 FlyBaseID:FBgn0050051 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001007749.1 Gene:Tmem18 / 362722 RGDID:1359389 Length:140 Species:Rattus norvegicus


Alignment Length:120 Identity:49/120 - (40%)
Similarity:71/120 - (59%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLSIDWKDPWLIGLILAHILTTTTALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSR 82
            ::..||.:|||:||:..|:|.......|......|:..||.|::.||..|.|||.||.||..|::
  Rat    18 IMETDWTEPWLLGLLAFHLLCLLLTCFSAQRYKLQIGHFLCLVVLVYCAEYINEVAAMNWRLFAK 82

  Fly    83 QQYFDSNGLFISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQ 137
            .|||||.|:|||.|||.|:|.|.|:::..|:..:..:|..||..|.:.:.||.|:
  Rat    83 YQYFDSRGMFISLVFSAPLLFNAMVIVIMWVRKTLTVMSDLKNLQERRKERKRRR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmem18NP_725169.3 TMEM18 15..133 CDD:291436 46/114 (40%)
Tmem18NP_001007749.1 TMEM18 14..127 CDD:291436 45/108 (42%)
DNA-binding. /evidence=ECO:0000250 113..140 7/25 (28%)
Nuclear localization signal. /evidence=ECO:0000250 130..138 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334317
Domainoid 1 1.000 99 1.000 Domainoid score I6976
eggNOG 1 0.900 - - E1_2AIGZ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17675
Inparanoid 1 1.050 104 1.000 Inparanoid score I4850
OMA 1 1.010 - - QHG58005
OrthoDB 1 1.010 - - D1575793at2759
OrthoFinder 1 1.000 - - FOG0007148
OrthoInspector 1 1.000 - - oto96233
orthoMCL 1 0.900 - - OOG6_104718
Panther 1 1.100 - - LDO PTHR22593
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5246
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.