DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmem18 and Tmem18

DIOPT Version :9

Sequence 1:NP_725169.3 Gene:Tmem18 / 246418 FlyBaseID:FBgn0050051 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_742046.2 Gene:Tmem18 / 211986 MGIID:2387176 Length:140 Species:Mus musculus


Alignment Length:124 Identity:53/124 - (42%)
Similarity:74/124 - (59%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLSIDWKDPWLIGLILAHILTTTTALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSR 82
            ::..||.:|||:||:..|:|.......|......|:..||.|::.||..|.|||.||.||..||:
Mouse    18 IMETDWTEPWLLGLLAFHLLCLLLTCFSSQRYKLQIGHFLCLVVLVYSAEYINEVAAVNWRLFSK 82

  Fly    83 QQYFDSNGLFISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKAD 141
            .|||||.|:|||.|||.|:|.|.||::..|:..:..:|..|||.| :||..:.|:.|.:
Mouse    83 YQYFDSRGMFISLVFSAPLLFNAMLIVIMWVRKTLTVMTDLKTLQ-EERKERRRRRKEE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmem18NP_725169.3 TMEM18 15..133 CDD:291436 51/114 (45%)
Tmem18NP_742046.2 TMEM18 14..127 CDD:291436 48/108 (44%)
DNA-binding. /evidence=ECO:0000250 113..140 8/26 (31%)
Nuclear localization signal. /evidence=ECO:0000250 130..138 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830602
Domainoid 1 1.000 104 1.000 Domainoid score I6724
eggNOG 1 0.900 - - E1_2AIGZ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17675
Inparanoid 1 1.050 108 1.000 Inparanoid score I4903
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58005
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007148
OrthoInspector 1 1.000 - - oto92670
orthoMCL 1 0.900 - - OOG6_104718
Panther 1 1.100 - - LDO PTHR22593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4869
SonicParanoid 1 1.000 - - X5246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.