DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmem18 and TMEM18

DIOPT Version :9

Sequence 1:NP_725169.3 Gene:Tmem18 / 246418 FlyBaseID:FBgn0050051 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001339610.1 Gene:TMEM18 / 129787 HGNCID:25257 Length:143 Species:Homo sapiens


Alignment Length:124 Identity:57/124 - (45%)
Similarity:76/124 - (61%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLSIDWKDPWLIGLILAHILTTTTALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSR 82
            ||..||.:|||:||...|.|......||..|...|:..||.|::.||..|.|||.||.||..||:
Human    21 LLQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSK 85

  Fly    83 QQYFDSNGLFISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKAD 141
            .|||||.|:|||.|||.|:|:|.|:::..|::.:..:|..||.|| :.|..|:|:.|.|
Human    86 YQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQ-ERRKEKKRRRKED 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmem18NP_725169.3 TMEM18 15..133 CDD:291436 53/114 (46%)
TMEM18NP_001339610.1 TMEM18 21..130 CDD:317209 50/108 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140631
Domainoid 1 1.000 107 1.000 Domainoid score I6551
eggNOG 1 0.900 - - E1_2AIGZ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I4872
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58005
OrthoDB 1 1.010 - - D1575793at2759
OrthoFinder 1 1.000 - - FOG0007148
OrthoInspector 1 1.000 - - oto89103
orthoMCL 1 0.900 - - OOG6_104718
Panther 1 1.100 - - LDO PTHR22593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4869
SonicParanoid 1 1.000 - - X5246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.