DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG34260

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:152 Identity:35/152 - (23%)
Similarity:65/152 - (42%) Gaps:6/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YYIEMKQMDC-VGNPNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIF 92
            |.|.:|.:.| :....|..:|.|.::..:...:....::.|.:..|.......:....|....|.
  Fly    23 YDIAIKTLGCQIIAKAYVNSLECLLVRQRTAVVAVKFSLNQTIEHFDVLATFDLIKKDKSRMNIA 87

  Fly    93 DITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGK-FESRNIS-VTD-LPPMLTESE 154
            ||..|.||.|....:..::..|...|...||... .||..||| :|.||.: ::| .||...:::
  Fly    88 DIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPD-SCPVSKGKLYEIRNYTFISDEFPPGAPQAK 151

  Fly   155 FFVNLDFFIPKVAIAMNVTLHG 176
            :.|.|. .:.:..:..::::.|
  Fly   152 WQVRLK-LLKRSELVADISIEG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 25/90 (28%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.