DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33721

DIOPT Version :10

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:64/169 - (37%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IEMKQMDC-VGNPNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPN--AKKVITQIF 92
            :|.....| |.:|.|.:..|| .|...|||       .:.:|:.:....|.|.|  ||..|::.|
  Fly    25 LEFTNFKCHVKDPTYLSFEYC-FIKSVNRT-------YKYISLKANMYEVPITNASAKLQISRRF 81

  Fly    93 ----DIT----FDVCKVLRERKRKILIDLLVNTLAK----------NSNAKAWRCPFPKGKFESR 139
                .||    .||||.:..:|.      |.|.:.:          |:|.|   ||:      ..
  Fly    82 RSYMPITIAASIDVCKYMAYKKN------LANPMLRLFEEITKKYTNTNHK---CPY------DH 131

  Fly   140 NISVTDLPPMLTESEFFVNL------DFFIPKVAIAMNV 172
            ::.:..||.... ||.|.|:      |:....:..:.|:
  Fly   132 DLIIDRLPSKYL-SEHFTNILPLPPGDYSFNSIWYSRNI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 23/107 (21%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 24/101 (24%)

Return to query results.
Submit another query.