DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33912

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:51/115 - (44%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FANLYCRIIPPKNRTME----ASVN-IMQQLSVFSGSLRVSIPNAK------KVITQ----IFDI 94
            |||:.|..:......:|    .||| ..:.:|:....|::.|...|      |..|.    :::.
  Fly    28 FANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISKVKIRFGLYKRFTGYKPFLYNA 92

  Fly    95 TFDVCKVLRERKRK------ILIDLLVNTLAKNS-NAKAWR-CPFPKGKF 136
            |.|.||.|:.....      |:.|::::.::.:| |.|..: .|||:|.:
  Fly    93 TLDACKFLKSPNSNPVALFFIIHDIVLDKMSYHSVNNKLTKILPFPEGHY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 14/59 (24%)
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.