DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33770

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:119 Identity:23/119 - (19%)
Similarity:44/119 - (36%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VGNPNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIFDITFDVCKVLR 103
            :.|...|.::|.|  .|..|...|.::           .|..:.|:|. ...:|..:.|||.::.
  Fly    53 IRNDKIFLDMYLR--KPLVRGWRARLD-----------FRTRVGNSKS-FQSLFSTSIDVCNIVN 103

  Fly   104 ERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTD--LPPMLTESEF 155
            ..|..:......|.|...:..:  :||.....:..|:....:  :||.:|...:
  Fly   104 AAKINLFKKWYKNLLKYGNFLR--QCPLNASHYYLRDWQFGEGLVPPFITSGSY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 13/68 (19%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.