DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33627

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster


Alignment Length:154 Identity:38/154 - (24%)
Similarity:78/154 - (50%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KQMDCVGNPNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIP-NAKKVITQIFDITFD 97
            |..:||.||:|.:...|.|:.|:...:.|.:..::.|:.|:.:.::.:| ...:...::.|:..|
  Fly    29 KTFNCVTNPDYISEHKCIIVEPEKSAISAELQYIKDLAQFNATFKLFMPRKPSRSFQKVIDVNVD 93

  Fly    98 VCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTD-LPPMLTESEFFVNLDF 161
            :|:..:.......:.:::....|..:  ..:||..||.:...||::.: ||..|.|::|.:.::|
  Fly    94 ICQFAKGIHGHRFMTIVIKAFGKQGS--QLKCPHTKGLYVYPNINIAENLPAFLPETDFKIEMNF 156

  Fly   162 FIPKVAIAMNVTLHGHLFEIAKER 185
            ..| .|..:|.||.|.||:..|.:
  Fly   157 LSP-AAHVINTTLTGFLFDPIKRK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 21/87 (24%)
CG33627NP_001027406.1 DUF1091 71..152 CDD:284008 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016868
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.