DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33784

DIOPT Version :10

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:141 Identity:33/141 - (23%)
Similarity:54/141 - (38%) Gaps:42/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YIEMK--QMDCVGNPNYFANLYCRI--IPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQ 90
            :.|:|  ::..:|......||:.::  :|.|:.|.     ::.....|||....           
  Fly    41 FCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTC-----VLTLFRRFSGYRPF----------- 89

  Fly    91 IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPF---------------------PKG 134
            :|::|.|||..|:.|||....||:.:.:...||.. ..|||                     |.|
  Fly    90 LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLN-HTCPFNHDIIVNQMVLNDDMISKAPVPNG 153

  Fly   135 KFESRNISVTD 145
            .::.|.|..||
  Fly   154 FYKLRFIVKTD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 22/77 (29%)
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 21/92 (23%)

Return to query results.
Submit another query.