DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33784

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:141 Identity:33/141 - (23%)
Similarity:54/141 - (38%) Gaps:42/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YIEMK--QMDCVGNPNYFANLYCRI--IPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQ 90
            :.|:|  ::..:|......||:.::  :|.|:.|.     ::.....|||....           
  Fly    41 FCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTC-----VLTLFRRFSGYRPF----------- 89

  Fly    91 IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPF---------------------PKG 134
            :|::|.|||..|:.|||....||:.:.:...||.. ..|||                     |.|
  Fly    90 LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLN-HTCPFNHDIIVNQMVLNDDMISKAPVPNG 153

  Fly   135 KFESRNISVTD 145
            .::.|.|..||
  Fly   154 FYKLRFIVKTD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 22/77 (29%)
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.