DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33688

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:168 Identity:43/168 - (25%)
Similarity:66/168 - (39%) Gaps:39/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGYYIEMKQMDCVGNPNYFANLYCRI------------IPPKNRT---MEASVNIMQQLSVFSGS 76
            :||      :..|.|...|.||.|.|            |...|||   ::..||:.||  |.:..
  Fly    11 LGY------LATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQ--VVNNV 67

  Fly    77 LRVSIPNAKKVITQIF-DITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFP-------- 132
            ..:.:..........| |:|.||||.|:: .|:.:|..|.:....|||.. ..||:.        
  Fly    68 TVIKLMRHNNGYKPFFVDVTIDVCKFLKD-PRQSIIKKLYDIYKNNSNIN-HTCPYKDVVIVHHL 130

  Fly   133 -KGKFESRNISVTDLPPMLTESEFFVNLDFFIPKVAIA 169
             .|..||..:..  ||  |.:.::.:..::.:..||.|
  Fly   131 WTGNLESDFMKY--LP--LIDGDYAIYTEWSVYNVARA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 25/90 (28%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.