DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33922

DIOPT Version :10

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:150 Identity:26/150 - (17%)
Similarity:57/150 - (38%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIVCSLDTADTAKLIPNMGYYIEMKQMDCVG-NPNYFANLYCRIIPPKNRTMEASVNIMQQLSVF 73
            :::|.|                |...:.||. :|.:....|| .:...|||.:.....::.|...
  Fly    19 LVICKL----------------EFTNIKCVTLDPEFAVFHYC-FLKSVNRTYKYYSLKVKLLKTP 66

  Fly    74 SGSLRVSIPNAKKVITQ---IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPF---- 131
            ..:::::|...:::...   ::::|.|.|:..:.::...:.....|.....||.. ..||:    
  Fly    67 VSNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNIN-HSCPYDHDI 130

  Fly   132 --PKGKFESRNISVTDLPPM 149
              .|......|..||::.|:
  Fly   131 ILDKVSISHANTQVTNVLPV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 13/68 (19%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 14/79 (18%)

Return to query results.
Submit another query.