DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33645

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster


Alignment Length:143 Identity:36/143 - (25%)
Similarity:71/143 - (49%) Gaps:21/143 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NLY----CRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIP----NAKKVITQIFDITFDVCKVLR 103
            :||    |::....|||...||:|.:: :|...::..::.    |:|:.: :::|:.|:.|.:|.
  Fly    39 DLYEKFECKVYQVDNRTYMDSVHIFKR-TVDDITVHAALDFWKLNSKQKM-KLYDVQFNGCYILE 101

  Fly   104 ERKRKILIDLLVNTLAKNSNAKAWRCPFPKG-KFESRNISVTDLPPMLTESEF--FVNLDFFIPK 165
            ...:..|.::.|..|.|:||.| ::|||... .:|.:|::       ::|.:|  ||.|..|...
  Fly   102 NANKNRLFNMYVQNLKKHSNVK-FKCPFRANVSYEVKNLT-------MSEQDFPSFVPLGKFRSL 158

  Fly   166 VAIAMNVTLHGHL 178
            :....|..|...:
  Fly   159 IEYCTNQKLRARV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 24/89 (27%)
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.