DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG14491

DIOPT Version :10

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:168 Identity:32/168 - (19%)
Similarity:65/168 - (38%) Gaps:35/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FANLYCRIIPP---------------KNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIFDI 94
            |.|..|....|               |..:....:...:.::.|..::|:.:|........:|::
  Fly     3 FTNCSCSSEDPEGMLSLLKCGLSKSVKRPSFNIELQFKKPVAKFFVNMRIVLPRRFGDDFTLFNL 67

  Fly    95 T-FDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKG------KFESRNISVTDLPPMLTE 152
            : .|.|.:|..:.:...|.|....:.:.||... |||:||.      .|.|   .:..:|....|
  Fly    68 SGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPK-RCPWPKDVNYYIRGFRS---DMATMPAFNFE 128

  Fly   153 SEFFVNLDFFIPKVAIAMNVTLHGHLFEIAKERNRRKK 190
            ::  :||.|   ::.:..:..:.|.:    :.|.:|:|
  Fly   129 TD--MNLWF---ELVVNQHKLIRGFI----QSRVQRRK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 20/93 (22%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 21/102 (21%)

Return to query results.
Submit another query.