DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33453

DIOPT Version :9

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:170 Identity:37/170 - (21%)
Similarity:75/170 - (44%) Gaps:17/170 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GIIVCSLDTADTAKLIPNMGYYIEMKQMDCVG-NPNYFANLYCRI-IPPKNRTMEASVNIMQQLS 71
            |:.:.:|....:....||    |::..:.|.. |.::....|||: ...:|:|   |:||.....
  Fly     9 GVFLAALFLISSVSEAPN----IKLTNVVCESINKSWAVFHYCRLKAYSRNKT---SLNINATFL 66

  Fly    72 VFSGSLRVSIPNAKKVITQ---IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPK 133
            ..:.::.:.:...|::...   :||:|.|.|:.||:|...::  .:..:..|:.:.....||:..
  Fly    67 HPTNNVSLRLKMVKRLSGYKPFLFDVTIDACQFLRKRHNPVI--KMFYSFIKDYSTLNHTCPYGL 129

  Fly   134 GKFESRNISVTDLPPMLTESEFFVNLDF-FIPKVAIAMNV 172
            ......:.:|..:|  |...::.|.||| |..|....:|:
  Fly   130 QVVSDYHTAVFPVP--LPSGDYGVLLDFIFYAKKQFHVNI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 21/87 (24%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.