DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30050 and CG33483

DIOPT Version :10

Sequence 1:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:169 Identity:38/169 - (22%)
Similarity:57/169 - (33%) Gaps:55/169 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IEMKQMDCVGNPNYFANL-YCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKV-ITQI-- 91
            :|...:.|......|.:. ||.:     :::..|...:        ||:|   |..|| ||::  
  Fly    75 VEFTNIKCTSWDKAFDDFEYCHL-----KSVNRSFKYL--------SLKV---NLHKVPITKVKV 123

  Fly    92 ---------------FDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNI 141
                           ::||.|.||.||..|...:..........:||.. ..|||      ..::
  Fly   124 NFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMN-HTCPF------DHDL 181

  Fly   142 SVTDLPPMLTESEFFVNLDFFIPKVAIAMNVTLHG-HLF 179
            .|..||......:  ||.|...|          || :||
  Fly   182 IVEKLPTNFMNQK--VNGDIKFP----------HGDYLF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30050NP_725159.2 DM8 90..177 CDD:214778 22/104 (21%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 22/103 (21%)

Return to query results.
Submit another query.