DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30049 and AT4G07670

DIOPT Version :10

Sequence 1:NP_725142.3 Gene:CG30049 / 246416 FlyBaseID:FBgn0050049 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_192510.1 Gene:AT4G07670 / 826236 AraportID:AT4G07670 Length:280 Species:Arabidopsis thaliana


Alignment Length:73 Identity:18/73 - (24%)
Similarity:28/73 - (38%) Gaps:16/73 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SYVVGTMTSIYQGIQNVVVKLSTASSNSSSYLLINSHFDTKPGSPGAGDDGTMVVVMLEVLRQMS 199
            ||:|       ..||||:..:. .......|:::.:|.||........:.||.|:        |.
plant   158 SYIV-------TKIQNVIGVIE-GEEEPDRYVILRNHRDTWTFRAVDPNSGTAVL--------ME 206

  Fly   200 ISESEFMH 207
            .|:|...|
plant   207 ASKSYLQH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30049NP_725142.3 M28_Fxna_like 71..378 CDD:349872 18/73 (25%)
AT4G07670NP_192510.1 PA <10..150 CDD:333703
Zinc_peptidase_like <163..>248 CDD:472712 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.