DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30047 and VPS70

DIOPT Version :9

Sequence 1:NP_725141.1 Gene:CG30047 / 246414 FlyBaseID:FBgn0050047 Length:879 Species:Drosophila melanogaster
Sequence 2:NP_012660.1 Gene:VPS70 / 853590 SGDID:S000003887 Length:811 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:66/323 - (20%)
Similarity:119/323 - (36%) Gaps:71/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PSGA----YMHWQMVNMYQGVTNVVVKISSRSSNSSSYLLVNSHFDSKPSSPGSGDDGTMVVVML 193
            ||.:    ::|.::....:.:::|.|.|....:...  :::.:|.||..|| .:||..:...::|
Yeast   404 PSSSIDKVHLHNELTYNIKEMSSVEVSIPGIFTEGE--IIIGAHRDSLASS-SAGDANSGSAILL 465

  Fly   194 EVLRQVAISDTPFEH------PIVFLFNGAEENPLEASHGFITQHKWAGNCKALINLEVAGSGGR 252
            |:.|.::   ...:|      ||..:....|.:.|..|..:...|......:||:.|.:..:   
Yeast   466 EIARGMS---KLLKHGWKPLRPIKLISWDGERSGLLGSTDYAEAHAAILRRRALVYLNLDNA--- 524

  Fly   253 DLLFQSGPN-----NPWLIKYYYQNAKHPFATTMAEEIFQSGILPSDTDFRIFRDYGQLPGLDMA 312
                .||.|     ||.|....|:.||      :.|       .....|:.:| |:.:.......
Yeast   525 ----ISGTNFHCKANPLLQDVIYEAAK------LTE-------FNGHEDWSLF-DHWKYTSNATI 571

  Fly   313 QISNGYVYHTIFDNVQAVPIDSLQSSGDNALSLV---RAFADAPEMQNPEDHSEG--HAVFFDYL 372
            .:.:|...:|.|.....||....|.:.::....|   .:..|:|.......:|:.  |.....::
Yeast   572 SLLDGLSSYTSFQYHLGVPAAHFQFNANDTSGAVYHSNSVFDSPTWLEKFTNSDYKLHNTMAMFV 636

  Fly   373 GLFFVYYTE------NTGIVL----NCCIA--------------VASLVLVVCSLLRMGRESD 411
            ||..:..:|      ||.:.|    |..||              |.||...|..||::..:.|
Yeast   637 GLTTLMLSENELARFNTHVYLKKIYNWYIAWHSNLSSAFPQDDEVNSLAKRVLDLLKVATQED 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30047NP_725141.1 M28_Fxna_like 72..379 CDD:193497 52/265 (20%)
VPS70NP_012660.1 Zinc_peptidase_like 135..>187 CDD:417508
PA_GCPII_like 187..413 CDD:239036 2/8 (25%)
M28_PMSA_TfR_like 419..649 CDD:349871 50/256 (20%)
TFR_dimer <731..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.