DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30047 and naalad2

DIOPT Version :10

Sequence 1:NP_725141.1 Gene:CG30047 / 246414 FlyBaseID:FBgn0050047 Length:879 Species:Drosophila melanogaster
Sequence 2:NP_956571.1 Gene:naalad2 / 393247 ZFINID:ZDB-GENE-040426-1025 Length:745 Species:Danio rerio


Alignment Length:251 Identity:52/251 - (20%)
Similarity:78/251 - (31%) Gaps:92/251 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 QDRRLYYPLENTSVNLTGLASTSSECDKYLMCGVPCFNHR--WC---------------KTRA-- 727
            |..|:|        |:.|....:.|.|:|::.|    .||  |.               ..||  
Zfish   338 QVTRIY--------NVIGWIRGAVEPDRYIILG----GHRDAWVFGGIDPVSGAAVVHENVRAAG 390

  Fly   728 ---KSHWLPRE---------QEVAIPGAT------SLKLLSKAV----LDSGKVARFEFEISGPP 770
               |..|.||.         :|..:.|:|      :..|..:||    .||.....:...:...|
Zfish   391 KLMKKGWRPRRTLIFASWDAEEFGLQGSTEWAEDNARVLQERAVAYINADSAIEGMYTLRVDCTP 455

  Fly   771 --HMSLY------IQPLDGVE----VEDWSFIRNMLDEPDTYSPPYQIFFAYGADNTPLKFHIDF 823
              |..:|      :.|.:|.|    .|.|                      :..||.|.|.....
Zfish   456 SLHTLVYDITKKVLSPEEGEEGMSLYESW----------------------HKRDNWPEKDKPWI 498

  Fly   824 AK--SSGDFSTPTFQLGFAASFVSYDYDRDAAGLKFISDFPDFAHVMEWPTLYERY 877
            :|  |..||.....:||..:....|..:|..   :..|.:|.:..|.|...:.||:
Zfish   499 SKLGSGSDFEAYFIRLGITSGRARYTKNRKT---ERYSSYPVYHSVYETYEIVERF 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30047NP_725141.1 M28_Fxna_like 72..379 CDD:349872
naalad2NP_956571.1 Zinc_peptidase_like 49..>103 CDD:472712
PA_GCPII_like 108..333 CDD:239036
M28_PSMA_like <341..581 CDD:349942 51/248 (21%)
TFR_dimer 613..733 CDD:461238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.