DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30047 and Naaladl1

DIOPT Version :10

Sequence 1:NP_725141.1 Gene:CG30047 / 246414 FlyBaseID:FBgn0050047 Length:879 Species:Drosophila melanogaster
Sequence 2:NP_001009546.1 Gene:Naaladl1 / 381204 MGIID:2685810 Length:745 Species:Mus musculus


Alignment Length:239 Identity:46/239 - (19%)
Similarity:77/239 - (32%) Gaps:78/239 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 TSVNLTGLASTSSECDKYLMCGVPCFNHR--WCKTRA---------------------KSHWLPR 734
            ||.|:.|:...:.|.|:|::.|    |||  |.....                     |..|.||
Mouse   350 TSSNVLGIIQGAVEPDRYVIYG----NHRDSWVHGAVDPSSGTAVLLEISRVLGTLLKKGTWRPR 410

  Fly   735 E---------QEVAIPGATSL--KLLSKAVLDSGKVARFEFEIS-----------GPPHMSLYIQ 777
            .         :|..:.|:|..  :.|||  |....||....:||           .||..|:...
Mouse   411 RSIIFASWGAEEFGLIGSTEFTEEFLSK--LQERTVAYINVDISVFSNATLRAQGTPPVQSVIFS 473

  Fly   778 PL--------DGVEVEDWSFIRNMLDEPDTYSPPYQIFFAYGADNTPLKFHIDFAKSSGDFSTPT 834
            ..        .|:.:.|     |.:...:..||.|.:..:.|.           ..:..|::...
Mouse   474 ATKEISAPGSSGLSIYD-----NWIRYTNRTSPVYGLVPSLGT-----------LGAGSDYAAFV 522

  Fly   835 FQLGFAASFVSYDYDRDAAGLKFISDFPDFAHVMEWPTLYERYI 878
            ..||..:..::|.|||.....:.   :|.:....:.....|:::
Mouse   523 HFLGITSMDLAYTYDRSKTSARI---YPTYHTAFDTFDYVEKFL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30047NP_725141.1 M28_Fxna_like 72..379 CDD:349872
Naaladl1NP_001009546.1 Zinc_peptidase_like 53..>126 CDD:472712
PA_GCPII_like 114..344 CDD:239036
M28_PSMA_like <350..592 CDD:349942 46/239 (19%)
TFR_dimer <648..739 CDD:461238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.