DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr65Au

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:107 Identity:36/107 - (33%)
Similarity:56/107 - (52%) Gaps:9/107 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQYTLLFIAALL-LSLAQARPQVRGQ-APGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGY 63
            ||...:::.|.| :.:..|.|  .|: |..|.|.:   |.| |....|.:.|||.|||:..|.|.
  Fly     1 MQSNFMWLVAFLAIGICLAFP--AGEDAQAETIKL---ESE-NTGDKYSFAYETSNGISRTETGE 59

  Fly    64 LK-NPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQ 104
            :| ..|.::.....|||.|:::|:|....|::.|||.|:.|:
  Fly    60 VKPGAGEEDGSLSVQGSTSWSAPDGKKYEISFTADETGYHPK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 21/55 (38%)
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.