DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and LOC5667565

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_001688325.2 Gene:LOC5667565 / 5667565 VectorBaseID:AGAMI1_001760 Length:483 Species:Anopheles gambiae


Alignment Length:105 Identity:29/105 - (27%)
Similarity:39/105 - (37%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADE-NGFQ 102
            |.:.:..|.|.|...:.:..:.    ||.....:|.|..||:|...|:|....:.|.||. |||.
Mosquito    70 EYDANPQYSYSYAVADAVTGDN----KNQQESRSGDVVTGSYSLVEPDGTRRTVEYNADPINGFN 130

  Fly   103 PQGDHLPTPPPIPPAIQK---ALAYLATAPPPPQEQPGGF 139
            ......|........|.|   .|||.|.|.......|.|:
Mosquito   131 AVVHREPLAVKAVAPIAKYAAPLAYPAVAKVAAPYAPYGY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 16/55 (29%)
LOC5667565XP_001688325.2 None

Return to query results.
Submit another query.