DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and LOC4576972

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_001230824.3 Gene:LOC4576972 / 4576972 VectorBaseID:AGAMI1_012517 Length:186 Species:Anopheles gambiae


Alignment Length:105 Identity:29/105 - (27%)
Similarity:39/105 - (37%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADE-NGFQ 102
            |.:.:..|.|.|...:.:..:.    ||.....:|.|..||:|...|:|....:.|.||. |||.
Mosquito    77 EYDANPQYSYSYAVADAVTGDN----KNQQESRSGDVVTGSYSLVEPDGTRRTVEYNADPINGFN 137

  Fly   103 PQGDHLPTPPPIPPAIQK---ALAYLATAPPPPQEQPGGF 139
            ......|........|.|   .|||.|.|.......|.|:
Mosquito   138 AVVHREPLAVKAVAPIAKYAAPLAYPAVAKVAAPYAPYGY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 16/55 (29%)
LOC4576972XP_001230824.3 None

Return to query results.
Submit another query.