DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr78Cb

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:87 Identity:37/87 - (42%)
Similarity:50/87 - (57%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DGSYKYLYETGNGINAEEEGYLKNPGTDNAGQVAQ--GSFSYTSPEGIPIRITYLADENGFQPQG 105
            :|.:||.::|.|||:.:.           ||...:  |.:|||||||:||...|:|||.||...|
  Fly    52 EGVFKYAFKTSNGIDVQA-----------AGSPLETIGIYSYTSPEGVPIETRYIADELGFHVVG 105

  Fly   106 DHLPTPPPIPPAIQKALAYLAT 127
            .|||.|||.|..|.::|.|:.|
  Fly   106 RHLPQPPPTPDYILRSLEYIRT 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 22/56 (39%)
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 22/56 (39%)

Return to query results.
Submit another query.