DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:142 Identity:54/142 - (38%)
Similarity:74/142 - (52%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QYTLLFIAALLLSLAQ-----ARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEE 61
            ::.:|.:|||.:|..|     ||.:.|           ..:.::..||||.|.|:|.|||..:|.
  Fly     3 KFFVLAVAALAVSCVQADSFDARAETR-----------EYKSDLKEDGSYAYQYQTSNGIAGQES 56

  Fly    62 GYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLA 126
            |.        .|..|.||.:|.:|:|..|::||.||.||:.|.|.|||||||||.:|.|:|.|:.
  Fly    57 GV--------GGYYASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIR 113

  Fly   127 TAPPPPQEQPGG 138
            |.|.....|..|
  Fly   114 THPQQESRQGQG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 22/54 (41%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 22/54 (41%)

Return to query results.
Submit another query.