DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Acp65Aa

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:100 Identity:42/100 - (42%)
Similarity:59/100 - (59%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQ 74
            ||||:||.||||       ..:.::..|.|....|.||:.|:..:|.:..|||.:.|.||||...
  Fly    12 ALLLALASARPQ-------NDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESI 69

  Fly    75 VAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLP 109
            ..:||.::.:|:|....|.::||||||||:|.|||
  Fly    70 SIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 21/54 (39%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 21/54 (39%)

Return to query results.
Submit another query.