DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:117 Identity:45/117 - (38%)
Similarity:65/117 - (55%) Gaps:17/117 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQYTLLFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEV-NFDG-----SYKYLYETGNGINAE 59
            |::|:......:|:.:.|.|           |.|:|:.:| .||.     .||:..||.:|.:.:
  Fly     1 MKFTIAIAFTCILACSLAAP-----------PAIQQDAQVLRFDSDVLPEGYKFAVETSDGKSHQ 54

  Fly    60 EEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTP 111
            |||.||:.|||:...|.:||::|...:|....|.||||||||||:|.|||.|
  Fly    55 EEGQLKDVGTDHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPRP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 25/54 (46%)
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 25/54 (46%)

Return to query results.
Submit another query.