DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Lcp9

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster


Alignment Length:99 Identity:28/99 - (28%)
Similarity:47/99 - (47%) Gaps:14/99 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTD 70
            :.:.|.||::..|         .|...:::.:.|||. ..:.|.||..|.|.|.:.|.||    :
  Fly     4 VIVLACLLAVVFA---------NEEADVVKSDSEVNL-LDFNYAYELSNHIRAVQTGALK----E 54

  Fly    71 NAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQ 104
            :...|..|.:.|.:|.|..:::.|.|||.|:.|:
  Fly    55 HDNWVVSGEYEYVAPNGKTVKVVYTADETGYHPK 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 18/54 (33%)
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 18/54 (33%)

Return to query results.
Submit another query.