DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:93 Identity:51/93 - (54%)
Similarity:63/93 - (67%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQVAQ-GSFSYTSPEGIPIRITY 94
            ||||:..:|.:.|||||..|||||.|..||.|:||:..|:..|.:.| |.:||.||||..:.:.|
  Fly    51 IPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQY 115

  Fly    95 LADENGFQPQGDHLPTPPPIPPAIQKAL 122
            .||||||:..|||:||||.||..|||.|
  Fly   116 TADENGFRATGDHIPTPPAIPEEIQKGL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 28/55 (51%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 28/55 (51%)

Return to query results.
Submit another query.