DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr49Ag

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster


Alignment Length:134 Identity:58/134 - (43%)
Similarity:73/134 - (54%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YTLLFI--AALLLSLAQARPQVRGQAPG--------EPIPIIRQEQEVNFDGSYKYLYETGNGIN 57
            |.|:|:  :|||||...||||  .|..|        ....|::|:...|.|||:...|||.|||.
  Fly     2 YKLVFLVCSALLLSYVLARPQ--DQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIR 64

  Fly    58 AEEEGYLKN---PGTDNA-GQVAQ----------GSFSYTSPEGIPIRITYLADENGFQPQGDHL 108
            .|..||||.   |.|:.: |||..          ||:||:.|:|..|.:.|:||||||||:||||
  Fly    65 VENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHL 129

  Fly   109 PTPP 112
            |..|
  Fly   130 PVAP 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 28/68 (41%)
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.