DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr49Ad

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:98 Identity:39/98 - (39%)
Similarity:54/98 - (55%) Gaps:19/98 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFD-GSYKYLYETGNGINAEEEGYLKNPGTD 70
            :|||     ||||             |:.|..:||:. |||.|.|||.|||:.||.|...|.|..
  Fly    61 YIAA-----AQAR-------------IVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQ 107

  Fly    71 NAGQVAQGSFSYTSPEGIPIRITYLADENGFQP 103
            ...:..:|::|:.:|||:.:.:.||||.|||:|
  Fly   108 QQEEQVEGAYSFITPEGLRVGVKYLADANGFRP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 23/54 (43%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 23/54 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.